PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000485.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 1042aa    MW: 113663 Da    PI: 5.1923
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000485.1_g00013.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28619670152
                   RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              aek++sl++l++yFs+++kdAAk +gvc+T+LKriCRq+GI+RWP+Rki+++
  Itr_sc000485.1_g00013.1 619 AEKHVSLSVLQQYFSGSLKDAAKAIGVCPTTLKRICRQHGISRWPSRKINKV 670
                              5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.075604690IPR003035RWP-RK domain
PfamPF020428.5E-26623670IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2407.4E-23912987No hitNo description
SuperFamilySSF542772.47E-20912991No hitNo description
SMARTSM006669.6E-21916995IPR000270PB1 domain
PROSITE profilePS5174520.526916991IPR000270PB1 domain
PfamPF005644.3E-18917989IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1042 aa     Download sequence    Send to blast
MLTAWNISDL GFNSLANLED NRDNVELEEE KGIGYFEMEG DEFSLDGTKC STADDSFNVT  60
AMDIMNFDAY AGWCNSPATM DQMLASFAFS PLTPVGYTQF DGLNYTEHNN GTFPMMDVAD  120
NIGSSEGGGE KINFQQNDQL TSLVTSTDVN DSVAKAKKNQ GQNCVVDFGS PMILKSPSEP  180
LAEKMLTALG LFKGSSGGGI LAQVWFPMKE GDKFFLSTYE QPFLLDHVLA GYREVSRKFT  240
FDAENKPGSV PGLPGRVFSS RIPEWTSNIA YYREAEYLRI HHAVNHEVRG SIALPVFEDD  300
QVETPCCAVL EVVTVKEKSD FDSEIEKVCQ ALQAVNLRSI APPSLSPKCL STNQKAALAE  360
ITDVLRAVCH AHRMPLALTW IPCSYVRGDS DDTRRVLCKG WIGNSTEKCV LCIESTACYI  420
SDKEMVGFVH ACTEHYLEEG QGIAGKALQS NHPFFYPDVK EYHISEYPLA HHARKFGLNA  480
AVAIRLRSTF TGNADYILEF FLPVNMKGST EQQLLLNNLS GTMQRICKTL RTVSDAELKG  540
GDGSKFGLQN ASNASIPNLP PFTLSRRNSQ HSLLDSTLDP TDEMHLNVSG SESSGTGADG  600
THQEKTGPRR QMEKKRSTAE KHVSLSVLQQ YFSGSLKDAA KAIGVCPTTL KRICRQHGIS  660
RWPSRKINKV SRSLKKIQTV LESVQGVEGG LKFDPTTGGL LAAGSIIQVP CKEVSKDKDS  720
LIQDAAQPAS CFDGGSPIIK MEEDCSVAGN QLPPSNLLRP SSYKGEHKST SPLSECCYDS  780
KLAALDAGPS WPACLNTIPW TGSGNAALDS SLIKGSSSRW GLNNSNLKSE NSDSPFVSQW  840
SSSMVVGDET ETKMKSANQV AGDDGIGEHN QPASSSMTDS SNGSGSMMNG SSSSSPSFGE  900
PKHLKTEVNC GDSGSKITVK ATYKEDTVRF KFDSSAGCSR LYEEVARRFQ LQNGTFQLKY  960
LDDEEEWVML VSDADLQECI EILDFLGTRT IVSGREDSPL DARKTAIRSP RSSGILLLMH  1020
FAAVDLGLKI HLVLFVETIC FT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795771.10.0PREDICTED: protein NLP9-like
RefseqXP_009795773.10.0PREDICTED: protein NLP9-like
RefseqXP_009795774.10.0PREDICTED: protein NLP9-like
RefseqXP_009795775.10.0PREDICTED: protein NLP9-like
RefseqXP_009795776.10.0PREDICTED: protein NLP9-like
RefseqXP_009795777.10.0PREDICTED: protein NLP9-like
RefseqXP_009795778.10.0PREDICTED: protein NLP9-like
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLK4D8J90.0K4D8J9_SOLLC; Uncharacterized protein
TrEMBLM1B0930.0M1B093_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000341880.0(Solanum tuberosum)
STRINGSolyc11g045350.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein